PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592772.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 765aa    MW: 85623.5 Da    PI: 6.4651
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592772.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.51.8e-21102157156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  XP_009592772.1 102 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKQLGLHPRQVKFWFQNRRTQIK 157
                     7999************************************************9877 PP

2START219.31.3e-682785023206
                     HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                      ++a++e+ k+a+++ep+W +s     e++n+de++++f+++++       + +ea+r++g+v+m+l++lv++++d++ qW+e+++    ka+t+
  XP_009592772.1 278 VNQAMEEVKKMATSGEPLWIRSFetgrEILNYDEYMKEFPTENSrdgrpnkRCIEASRETGIVFMELPRLVQTFMDVN-QWKEMFPsmisKAATV 371
                     57899*****************99***************99999******999*************************.**************** PP

                     EEECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  83 evissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                     +vi++g       ga+qlm+ae q+l+p+v  R+++fvRy++ql+ g+w+ivdvSvd  +++  ++s+v++++lpSg+ +++ sn h+kvtwveh
  XP_009592772.1 372 DVICNGegancwdGAVQLMFAEVQMLTPVVGtREVYFVRYCKQLSVGQWAIVDVSVDKVEDNI-DASLVKCRKLPSGCFLQEQSNAHCKVTWVEH 465
                     *************************************************************98.9****************************** PP

                     EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      +++++++h+l+r++v+sg+a+ga++w atlq+qce+
  XP_009592772.1 466 LECQKSTVHSLYRVIVNSGQAFGARRWIATLQQQCER 502
                     ***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-2288153IPR009057Homeodomain-like
SuperFamilySSF466891.46E-2090160IPR009057Homeodomain-like
PROSITE profilePS5007118.09199159IPR001356Homeobox domain
SMARTSM003893.2E-19101163IPR001356Homeobox domain
PfamPF000468.8E-19102157IPR001356Homeobox domain
CDDcd000866.09E-17106157No hitNo description
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PROSITE profilePS5084837.492267505IPR002913START domain
SuperFamilySSF559613.85E-33269502No hitNo description
CDDcd088756.43E-108271501No hitNo description
SMARTSM002349.8E-63276502IPR002913START domain
PfamPF018523.4E-55278502IPR002913START domain
Gene3DG3DSA:3.30.530.206.2E-6279501IPR023393START-like domain
SuperFamilySSF559614.53E-12532752No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MGVVDMSNNH PPPHETKDFF PSPALSLSLA GIFRDGGNGE TEEVEDGSGS RGRPREESTV  60
EISSETSGPL RSRGSDDDFE HDDITWNEDE EDPNNNSKKK KRKKYHRHTA EQIREMEALF  120
KESPHPDEKQ RQQLSKQLGL HPRQVKFWFQ NRRTQIKAIQ ERHENSLLKA EIEKLREENK  180
GLRKTLKNPS CPNCGFACSS NDAPTLPAEE HQLRIENARL RAEVEKLRAA LGKYPIGTSP  240
NNNSSSSCSG GNEEENRSAL DYYTGIFGLE KSRIMHVVNQ AMEEVKKMAT SGEPLWIRSF  300
ETGREILNYD EYMKEFPTEN SRDGRPNKRC IEASRETGIV FMELPRLVQT FMDVNQWKEM  360
FPSMISKAAT VDVICNGEGA NCWDGAVQLM FAEVQMLTPV VGTREVYFVR YCKQLSVGQW  420
AIVDVSVDKV EDNIDASLVK CRKLPSGCFL QEQSNAHCKV TWVEHLECQK STVHSLYRVI  480
VNSGQAFGAR RWIATLQQQC ERLLFSMATN IPTKDTTGVA TLAGRKSILT LAQRMTWSFY  540
RMLGASSYNT WNKIPSKTGQ EDIRVASRKN LTDTGEPQGV ILCAVSSIWL PVSRNLLFDF  600
LKDETRRHEW DVMSNGGPAQ SVANLAKGQD KGNAVSIQAV KLRENNMWIL QDTCTNAYES  660
AVVYAPVDIA GMQSVITGCD SSNTAVLPSG FSILPDGIES RGLVITSKPE DRSSEGGSLL  720
TIAFQILTSN SPTAKLSKES VESVNNLLSC TLHKIKTSFQ CDDAY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
197102KKKKRK
297103KKKKRKK
399103KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755151e-113HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592772.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2-like isoform X1
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A0V0IS600.0A0A0V0IS60_SOLCH; Putative homeobox-leucine zipper protein GLABRA 2-like
STRINGPGSC0003DMT4000067700.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62282328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein